PROTEIN PROPERTIES properties of NFIA_013050 [help]
property value
organism
Neosartorya fischeri NRRL 181
product name sexual development activator VeA
sequence length 571 aa
loaded 2013-08-16 04:47:00
last modified 2013-08-16 04:47:00
ASPGD DATA SOURCE source of sequence & annotation for NFIA_013050
Neosartorya fischeri NRRL 181 was Sequenced by JCVI. Sequence and annotation downloaded from the Broad Institute Aspergillus download page on 23-Feb-2009.
DATABASE REFERENCES database refs for NFIA_013050 [help]
database accession id type
GFF3 NFIA_013050 gff_id
NCBILocus NFIA_013050 locus_id
PROTEIN CLUSTERS clusters of which NFIA_013050 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
1099437636249_N_fischeri_NRRL_181 (4.68 Mb) 1673653-1675435 +
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of NFIA_013050:
SEQUENCE the amino acid sequence in FASTA format [help]
>NFIA_013050 polypeptide
MATRPPLMPPANETESSVSRITREGKKITYKLSVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFES
DPNDDLHKTDITFAYNANFFLFATLDTARPMAQGRLTGPPTCPVLTGVPVAGVAYLDRPQQAGYFIFPDL
SVRHEGRYRLSFHLYEEIKDVKDADKDTPMPDVNSSINLTKPSAPKSHLNFRLEVKSVPFTVYSAKKFPG
LATSTSLSRIIAEQGCRVRIRRDVRMRRRGEKRTDDYDFDDERVFATRSDRYTTPDMYAANSAERARSTS
ISTTADASFPYGSDAQRRPSASDYGFQGAQPYQRSIPAAPAAPAPAPVHNPATSAQTSTYQSHLSFGATQ
SQYPAPQLPPTPQSATPTNTYSPHPSYSHSRNPSNGTEYDATPSGYPYPQPRLPAERPSYSKAALPPLRL
EPPKAPNMQTSTDSRPSDANAYPTLSQPPVPRAPTPANHVTSLPPLKVLSGEYSHPSQPNAQSPHHDLGS
GKRLLWETNHSLSKRSHEETFGNDERPLHNGMRPDMDQYPSMGRKQPDYGRLPFYTDSRDEMAYKRANGR
MVMKISPALP*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators