PROTEIN PROPERTIES properties of Aspwe1_0501856 [help]
property value
organism
Aspergillus wentii
product name
sequence length 572 aa
loaded 2013-08-15 14:45:00
last modified 2013-08-15 14:45:00
ASPGD DATA SOURCE source of sequence & annotation for Aspwe1_0501856
Aspergillus wentii was Sequenced by JGI. Sequence and GFF annotation downloaded from the JGI v1.0 download page on 14-Jan-2013.
DATABASE REFERENCES database refs for Aspwe1_0501856 [help]
database accession id type
GFF3 Aspwe1_0501856-P gff_id
PROTEIN CLUSTERS clusters of which Aspwe1_0501856 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scaffold_4 (4.13 Mb) 1638680-1640465 +
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of Aspwe1_0501856:
SEQUENCE the amino acid sequence in FASTA format [help]
>Aspwe1_0501856 polypeptide
MATRAPMLAPVNETTHSVSRVTREGKKLTYKLAVMQQPERARACDAGAKSSADRRPVDPPPVVELRIFES
DPNDDMHQTDITFAYNANFFLFATLDTARPIAHGRVPAIPSCPVLTGVPVAGVAYLDRPTQAGYFIFPDL
SVRHEGRYRLNFNLYEEIKDPKDADKDTPMQNTMARSPLSKPTAPQSSLNFRLEVKSAPFSVYSAKKFPG
LSTSTALSRVIAEQGCRVRIRRDVRMRRRGDKRTEDYEFDEERVYARSSDKYQTPDAHVTTPFERPRSTS
TSTIDPQYAYGPDAQRRPSATDYGFPAPPPYQRTIPPGPPGPAPPTPSHAQAYNSHLTFTATQSQSQYQA
PPLPPTQQVANPPSAYSPHISHVHTRSSSNATEYEPAPSGHPYSQPRPTERPGFSDRPGFFDGTALPPLR
LDLPKTMGMQPPVERRSSNPTEYQSMAQSAAPRSQTPVTSLPSFKSLSGGFPQNNYRQPSASLPSPGPVH
EHGEKRLYDTGPSLAKRSHGESFGLDDRPLRNGMRPDTESYPGNPKISDAQAEFYNDTFPDEMAYKRANG
RMARKAPPKLQ*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators