PROTEIN PROPERTIES properties of Asptu1_0186752 [help]
property value
organism
Aspergillus tubingensis
product name
sequence length 557 aa
loaded 2013-08-15 20:43:00
last modified 2013-08-15 20:43:00
ASPGD DATA SOURCE source of sequence & annotation for Asptu1_0186752
Aspergillus tubingensis was Sequenced by JGI. Sequence and GFF annotation downloaded from the JGI v1.0 download page on 14-Jan-2013.
DATABASE REFERENCES database refs for Asptu1_0186752 [help]
database accession id type
GFF3 Asptu1_0186752-P gff_id
PROTEIN CLUSTERS clusters of which Asptu1_0186752 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scaffold_1 (4.80 Mb) 2898310-2900052 -
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of Asptu1_0186752:
SEQUENCE the amino acid sequence in FASTA format [help]
>Asptu1_0186752 polypeptide
MATRPPLSPPVNETEHSVSRITREGKRITYKLNVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFES
DPNDDVHKTDITFAYNANFFLFATLETARPMAQGRLAPTPTFPVLTGVPVAGVAYLDRPSQAGYFIFPDL
SVRHEGVYRLSFHLYEETKDSKDADESAPIRSPMMKGKPSIPKSFLNFRLEVVSVPFTVFSAKKFPGLTT
STSLSRIIAEQGCRVRIRRDVRMRRRGDKRSDDYDFDEERSHRGRIPDRYSTPDAYANPVERPRSTSIGS
VDPAFSYGPEAPRRPSATEYGFPNPQAYPRAIPPAPAPAPPASSTPTPVAPIAPSSRSSSYTSHLSFGAT
RTQYPAPQLPGTPQSATTPTQVYSPHPTYTHTRNPSASTEYETMPSGYPPSRLPAERSTYSKPLPPIRVL
HPSDPTAYRAMANPVPPRAPTPSNAAPSLPPIASISAEYSNNLPQPPSNLAPSPNREPRGFLWDTRTAAS
SKRPHEDAFGHSERPLYNGMRPDSDSYPSADRRPSDVHRAALLSDRDEMAYKRANGRMATKISPAI*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators