PROTEIN PROPERTIES properties of Aspsy1_0140011 [help]
property value
organism
Aspergillus sydowii
product name
sequence length 587 aa
loaded 2013-08-16 09:05:00
last modified 2013-08-16 09:05:00
ASPGD DATA SOURCE source of sequence & annotation for Aspsy1_0140011
Aspergillus sydowii was Sequenced by JGI. Sequence and GFF annotation downloaded from the JGI v1.0 download page on 15-Sep-2012.
DATABASE REFERENCES database refs for Aspsy1_0140011 [help]
database accession id type
GFF3 Aspsy1_0140011-P gff_id
PROTEIN CLUSTERS clusters of which Aspsy1_0140011 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scaffold_1 (5.54 Mb) 1141657-1143484 -
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of Aspsy1_0140011:
SEQUENCE the amino acid sequence in FASTA format [help]
>Aspsy1_0140011 polypeptide
VKTAARAPPPAPVNETDHSVSRITREGKKITYRLNVMQQPERARACGAGAKSSADRRPVDPPPVVEMRIF
ESDPHDDTHKTDITFAYNANFFLFATLETARPMAQGRLAPTPSCPVLTGVPVAGVAYLDRPSQAGYFIFP
DLSVRHEGVYRLSFHLFEQTKDAKDATEGTQPMPPPVPGKLSAPQQFLDFRLEVVSVPFMVYSAKKFPGL
TTSTNLSRVIAEQGCRVRIRRDVRMRRRGDKRTDDYDYDEERMYNGRRADRYVTPDAYVNAPERPRSTSI
STVDHAYGYPSQRRPSGAEYGPTNPQAYQRPMPSTPAPSSTPIPPSITAPGPVTMPSSTPSPASTHAPAP
TAAHPPLHTPSYQSHLSFGSTQTQYPAPPLSHVPQPAATPTNMYSPRPSISHGRNPSTSTEYEHSYPYPH
SRIQAERPQSYPKPPTASLPPLRLPNTFNMQPGEGHHSLEAPRIPRSQTPSNMVTSLPPIQTLPELPPAS
SQPASSIGSSPGNDYGPVKGLWETNQTLSKRTHEETFGHDERPLYNGMRPDSEAYPGGMQRRPSHDRVSS
LFGGSDQMAYKRANGRMVSKISPAMH*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators