PROTEIN PROPERTIES properties of Aspka1_0178703 [help]
property value
organism
Aspergillus kawachii
product name
sequence length 556 aa
loaded 2013-08-16 10:56:00
last modified 2013-08-16 10:56:00
ASPGD DATA SOURCE source of sequence & annotation for Aspka1_0178703
Aspergillus kawachii was Sequenced by Taiki Futagami et al, Kyushu University, Japan. Sequence and GFF annotation downloaded from the JGI v1.0 download page on 07-Apr-2013.
DATABASE REFERENCES database refs for Aspka1_0178703 [help]
database accession id type
GFF3 Aspka1_0178703-P gff_id
PROTEIN CLUSTERS clusters of which Aspka1_0178703 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scaffold_017 (733.80 kb) 288025-289764 -
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of Aspka1_0178703:
SEQUENCE the amino acid sequence in FASTA format [help]
>Aspka1_0178703 polypeptide
MATRPPLSPPVNETEHSVSRITREGKRITYKLNVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFES
DPNDDVHKTDITFAYNANFFLFATLETARPMAQGRLAPTPTFPVLTGVPVAGVAYLDRPSQAGYFIFPDL
SVRHEGVYRLSFHLYEETKDSKDADESAPIRSPMMKGKPSIPKSFLNFRLEVVSVPFTVFSAKKFPGLTT
STSLSRIIAEQGCRVRIRRDVRMRRRGDKRSDDYDFDEERSHRGRIPDRYSTPDAYANPVERPRSTSIGS
VDPAFSYGPEAPRRPSATEYGFPNPQAYPRAIPPAPAPAPPASSTPTPVAPIAPSRSSSYTSHLSFGATR
TQYPAPQLPGTPQSATTPTQVYSPHPTYTHTRNPSTSTEYEPMPSGYPPSRLPAERSTYSKPLPPIRVLH
PSDPTAYRAMANPVPPRAPTPSNAAPSLPPIASISAEYSNNLPQPPSNLAPSPNREPRGFLWDTRTAASS
KRPHEDAFGHSERPLYNGMRPDNDSYPSADRRPSDVHRAALLSDRDEMAYKRANGRMATKISPAI*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators