PROTEIN PROPERTIES properties of Aspgl1_0178124 [help]
property value
organism
Aspergillus glaucus
product name
sequence length 575 aa
loaded 2013-08-15 16:13:00
last modified 2013-08-15 16:13:00
ASPGD DATA SOURCE source of sequence & annotation for Aspgl1_0178124
Aspergillus glaucus was Sequenced by JGI. Sequence and GFF annotation downloaded from the JGI v1.0 download page on 14-Jan-2013.
DATABASE REFERENCES database refs for Aspgl1_0178124 [help]
database accession id type
GFF3 Aspgl1_0178124-P gff_id
PROTEIN CLUSTERS clusters of which Aspgl1_0178124 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scaffold_21 (553.16 kb) 448268-450043 -
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of Aspgl1_0178124:
SEQUENCE the amino acid sequence in FASTA format [help]
>Aspgl1_0178124 polypeptide
MATRMPLMPPENETEAHFSRITREGKRISYKLSVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFES
DPNNDLHKTDITFAYNASFFLYATLQTARPIANGRVAGTPSTPVLTGVPVAGIAYLDRPSQAGYFIFPDL
SVRHEGQYRLTFHLYEETKDPKDADRDPPMPDTTVQPLKPGASTPDAFNFRLLVNSVPFTVYSAKKFPGL
ATSTSLSRIIAEQGCRVRIRRDVRMRRRGDKRNDDYDEYAAAPRQADNRYSTPDAYAAAAAAAAAAAATP
IERPRSASTSTIEPAFPYAPDAQRRSSASDYGYPCAQPYQRAIPAAPPAAPAPVPAPQASPYTSHLSFGS
AQPQYHAPQLPPTPQATAPVNPYSPHLSYSHTRNPSTEYEPTGYPYPQPRPHTERTSSYPTPLPPLRLEP
PKGFMQPAGEFRSSDPNAYHQSQTQPPAPRSQTPSTGLVPSLPPLSSLSGGSEYVHNMPSSMVPHPSHEM
TPGKRFLYDVPGPKLSKRSHEDSFGFDERPMQNGMRPDTELYPSMERKLSESSRAYFCGETRDEMAYKRA
NGRMAMKIPPAYSS*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators