PROTEIN PROPERTIES properties of Aspbr1_0121725 [help]
property value
organism
Aspergillus brasiliensis
product name
sequence length 559 aa
loaded 2013-08-16 08:34:00
last modified 2013-08-16 08:34:00
ASPGD DATA SOURCE source of sequence & annotation for Aspbr1_0121725
Aspergillus brasiliensis was Sequenced by JGI. Sequence and GFF annotation downloaded from the JGI v1.0 download page on 15-Sep-2012.
DATABASE REFERENCES database refs for Aspbr1_0121725 [help]
database accession id type
GFF3 Aspbr1_0121725-P gff_id
PROTEIN CLUSTERS clusters of which Aspbr1_0121725 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scaffold_4 (2.97 Mb) 1761722-1763470 +
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of Aspbr1_0121725:
SEQUENCE the amino acid sequence in FASTA format [help]
>Aspbr1_0121725 polypeptide
MATRPPLSPPVNETEHSVSRITREGKRITYKLNVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFES
DPNDDVHKTDITFAYNANFFLFATLETARPMAQGRLAPTPTFPVLTGVPVAGVAYLDRPSQAGYFIFPDL
SVRHEGIYRLSFHLYEETKDSKDADESAPMRSPMMKGNAKPSIPKSFLNFRLEVVSVPFTVFSAKKFPGL
TTSTSLSRIIAEQGCRVRIRRDVRMRRRGDKRSDDYDFDEERSHRGRLPDRYSTPDTYANPVERPRSTSI
GSVDPAFSYGPEAPRRPSATEYGFPNPQTYPRPMPPAPAPAPPSSSTPTPVAPIAPSSRSSSYTSHLSFG
ATRTQYPAPQLPGTPQSATTPTQVYSPHPTYAHARNPSTSTEYEPMPSGYPSSRLPAERSTYSKPLPPIR
VLHPSDPTAYRAMANPVAPRSQTPSNAAPSLPPIASISAEYSNNLPQPPSNLAPSPNREPRGFLWDTRTA
ASSKRPHEDAFGHSERPLYNGMRPDNDNYPSADRRPSDVHRAALLSDRDEMAYKRANGRMATKISPAI*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators