PROTEIN PROPERTIES properties of AFUB_011960 [help]
property value
organism
Aspergillus fumigatus A1163
product name
sequence length 571 aa
loaded 2013-08-17 10:13:00
last modified 2013-08-17 10:13:00
ASPGD DATA SOURCE source of sequence & annotation for AFUB_011960
Aspergillus fumigatus A1163 was Sequenced by JCVI. Sequence and annotation downloaded from GenBank on 24-Feb-2009.
DATABASE REFERENCES database refs for AFUB_011960 [help]
database accession id type
GFF3 AFUB_011960-Protein gff_id
PROTEIN CLUSTERS clusters of which AFUB_011960 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scf_000001_A_fumigatus_A1163 (4.90 Mb) 3357377-3359160 -
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of AFUB_011960:
SEQUENCE the amino acid sequence in FASTA format [help]
>AFUB_011960 polypeptide
MATRPPLMPPANETESSVSRISREGKKITYKLSVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFES
DPNDDLHKTDITFAYNANFFLFATLETARPMAQGRLTGPPTCPVLTGVPVAGVAYLDRPQQAGYFIFPDL
SVRHEGRYRLSFHLYEEIKDIKDADKDTPMPDLNSSTNLTKPSAPKAHLNFRLEVKSVPFTVYSAKKFPG
LATSTSLSRIIAEQGCRVRIRRDVRMRRRGEKRTDDYDFDDERAFATRSDRYTTPDMYAANSAERARSTS
ISTTADTSFPYGSDAQRRPSAGDYGFQGAQPYQRSMPAASAAPAPAPVHSPATSAQTSSYQSHLSFGATQ
SQYPAPQLPPTPQSATPTNTYSPHPSYSHSRNPSNGTEYDATSSGYPYPQPRLPADRPSYSKAALPPLRL
EPPKAPNMQTSTDSRSSDANAYPTLSQPPVPRAPTPANHVTSLPPLKVLSGEYSHPSQPNAQSPHHDLGS
GKRLLWETNHTLSKRSHEETFGSDERPLHNGMRPDMDQYPSMGRKQPDYGRLPFYTDSRDEMAYKRANGR
MVMKILPALP*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators