PROTEIN PROPERTIES properties of AFL2G_07468 [help]
property value
organism
Aspergillus flavus NRRL 3357
product name hypothetical protein similar to veA | PASA_update:single gene model update incorporated PASA_asmbls:[pasa:asmbl_4530,status:13]
sequence length 550 aa
loaded 2013-08-16 07:43:00
last modified 2013-08-16 07:43:00
ASPGD DATA SOURCE source of sequence & annotation for AFL2G_07468
Aspergillus flavus NRRL 3357 was Sequenced by JCVI. Sequence and annotation downloaded from the Broad Institute Aspergillus download page on 23-Feb-2009. Gene models subsequently refined at AspGD by PASA alignment of A. oryzae ESTs.
DATABASE REFERENCES database refs for AFL2G_07468 [help]
database accession id type
GFF3 AFL2T_07468 gff_id
NCBILocus AFL2G_07468 locus_id
PROTEIN CLUSTERS clusters of which AFL2G_07468 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
1041045516891_A_flavus_NRRL_3557 (2.08 Mb) 590391-592183 +
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of AFL2G_07468:
SEQUENCE the amino acid sequence in FASTA format [help]
>AFL2G_07468 polypeptide
MATRAPLAPPPNETEASVSRITREGKKLTYKLKSSADRRPVDPPPVVELRVYESDPNDDLNKTDITFAYN
ANFFLYATLETARPMAQGRFAPNPTCPVLTGVPVAGVAYLDRPSQAGYFIFPDLSVRHEGVYRLNFHLYE
ETKESKDANENAPIQSHVQPNAIEARWRRSHSWSFVSSAKKFPGLATSTSLSRVIAEQGCRVRIRRDVRM
RRRGEKRTDDYDYDEERVYRSSDRISTPDTHGYAGTPVERPRSTSTSTVDPSFPYGVDAQRRSSGATEYG
FQGAQPYQRPLPPAPGPAPAAVSTPAPPAPPAPPSHNPGYQSHLSFGSTQTQYPAPQLPPTPQTASTLAA
PYSPHPSYSHARNPSTSAEYETPGYSYPPSRMSTERSSYPKNGLPPLRLEPPKPLNMPSGEPRSSDPNAY
HSVAQSAAPRSQTPSSSLVPSLPPLKALSGDYPNNLSQSSSSTSQSPSHDLGAGKKFFWDTGASLSKRSY
EDSFGHDDRPLYNGMRPDTESYPRRLSDASRNFYNETRDEMAYKRANGRMATKISPALQ*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators