PROTEIN PROPERTIES properties of ACLA_022920 [help]
property value
organism
Aspergillus clavatus NRRL 1
product name sexual development activator VeA
sequence length 579 aa
loaded 2013-08-16 11:47:00
last modified 2013-08-16 11:47:00
ASPGD DATA SOURCE source of sequence & annotation for ACLA_022920
Aspergillus clavatus NRRL 1 was Sequenced by JCVI. Sequence and GFF annotation downloaded from the Broad Institute Aspergillus download page on 23-Feb-2009.
DATABASE REFERENCES database refs for ACLA_022920 [help]
database accession id type
GFF3 ACLA_022920 gff_id
NCBILocus ACLA_022920 locus_id
PROTEIN CLUSTERS clusters of which ACLA_022920 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
1099423829805_A_clavatus_NRRL_1 (4.49 Mb) 1425875-1427677 -
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of ACLA_022920:
SEQUENCE the amino acid sequence in FASTA format [help]
>ACLA_022920 polypeptide
MATRAPLLPPANETENSVSRITREGKKITYKLSVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFES
DPNDDLHKTDITFAYNANFFLFATLDTARPMAHGRLAGPPTFPVLTGVPVAGVAYLDRPQQAGYFIFPDL
SVRHEGRYRLSFHLYEEIKDAKDADKDTPMPDVNPSMNLSKPSAPRSHLNFRLEVKSVPFTVYSAKKFPG
LATSTSLSRIIAEQGCRVRIRRDVRMRRRGEKRTDDYDFDDERVFGTRSDRYTTPDAYAANSAERARSTS
ISTTVDPSYPYGSDGQRRPSAGDYGFPGAQPYQRAMPPAPAPVPVPASVPTPVPTGPPASYQSHLSFGST
QAQYPAPQLPPTPQSATPTNTYSPHPTYSHSRNSSNGAEHEAASVGYPYPQPRLPAERPSYHTAALPPLR
LEPPTKAPNMQPAADPRAIDASAYQPLSQPTVPRAQTPSNHVTSLPPLKTISGEYHQNSSQSSNGFVQSP
SPSHDTGSGKRMFWETNNTSSKRSHDDTFGHDERPLHNGMRPDADPYPGMGRKQSEYSRVSFYADSRDEM
AYKRANGRMVMKISPALP*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators