PROTEIN PROPERTIES properties of Aacu16872_056272 [help]
property value
organism
Aspergillus aculeatus ATCC16872
product name Aacu16872_056272
sequence length 519 aa
loaded 2013-08-16 05:50:00
last modified 2013-08-16 05:50:00
ASPGD DATA SOURCE source of sequence & annotation for Aacu16872_056272
Aspergillus aculeatus ATCC16872 was Sequenced by JGI. Sequence and GFF annotation downloaded from the JGI v1.1 download page on 06-Aug-2011.
DATABASE REFERENCES database refs for Aacu16872_056272 [help]
database accession id type
GFF3 Aacu16872_056272-P gff_id
PROTEIN CLUSTERS clusters of which Aacu16872_056272 is a member [help]
cluster program algorithm analysis description
asp2_v6.match.13343801.1 j_ortholog_clusters j_ortholog_clusters Jaccard Orthologous clusters (multiple genomes)
GENOMIC CONTEXT genomic context of the gene [help]
sequence location strand
scaffold_1 (3.73 Mb) 1911814-1913517 +
display at most: 5 kb 10 kb 15 kb 25 kb 50 kb on either side of Aacu16872_056272:
SEQUENCE the amino acid sequence in FASTA format [help]
>Aacu16872_056272 polypeptide
MASRPPLSPPVNETEHSVSRITREGKKLTYKLTVMQQPERARACGAGAKSSADRRPVDPPFGRLAPTPTF
PVLTGVPVAGVAYLDRPFPAGFFIFPDLSVRHEGLYRLSFHLYEETKESKDVDEGAPIPSPMLKTNPSKP
MTPKSFLEFRLEVVSVPFTVFSAKKFPGLTQSTHLSRIIAEQGCRVRIRRDVRMRRRGDKGSDDYDYDED
RMMSSRRDRYSTPDTYPTPAERPRSTSIGTVDQGYGPEASRRPSAAEYGFQNPRLYQHPIAHAPAPTTAS
TPSPVTPAAFATQNSTYQSHLSFGSTQAQYSAPQIPRNPSSGSMPVTAYSPHPTHSHSRNPSTSTEHEKD
AHRIYLPPIRLDPSHPAPSPTESRSSDPPMYPVVAQHTPAHPSRSGNILPPISAISGEIPINMPRPQNNT
ASSPVHEIAQNKRLLWDTNSGPTFSKRTHEESFGHAERPLHNGMRPDREPTPPLERRLSDARREASYSLS
RDELAYKRANGRMVTKISPAMIHHGQSL*

  AspGD comparative displays powered by Sybil.  
Return to AspGD
Send a Message to the AspGD Curators